Antlers Antler
![]() |
![]() Legendary Whitetails Outfitter Hoodie Deer gear hooded sweatshirt Antler White $29.99 Time Remaining: 18d 15h 11m Buy It Now for only: $29.99 |
![]() MULE DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $351.00 (10 Bids) Time Remaining: 57m |
![]() NO RESERVE HUGE 105 + CHARACTER SHED WHITETAIL ANTLER $71.00 (7 Bids) Time Remaining: 35m |
![]() Antler King Mini Max Food Plot Blend $17.00 Time Remaining: 21d 19h 42m Buy It Now for only: $17.00 |
![]() NO RESERVE HUGE 90 + SUPER LOOKER HEAVY MASS SHED WHITETAIL ANTLER $113.50 (7 Bids) Time Remaining: 37m |
![]() RATTLE SNAKE POLYRESIN DECOR LIFE LIKE WHITETAIL DEER ANTLERS DEER SHEDS $30.00 Time Remaining: 7d 21h 38m Buy It Now for only: $30.00 |
![]() nice BIG 9 point from PA WHITETAILdeer antlers taxidermy shed rack buck horn $8.50 (5 Bids) Time Remaining: 49m |
![]() DEER HORNS ANTLERS NO SKULL SKULLS COW BULL DL0007 $3.81 (4 Bids) Time Remaining: 57m |
![]() 20 ANTLER SLICESORNAMENTSJEWELERYDESIGNCARVINGDECORREALELKBUTTONSREAL $9.99 Time Remaining: 25d 19h 24m Buy It Now for only: $9.99 |
![]() 11 POINT WHITETAIL DEER MOUNT 135 taxidermy with replica antlers log homes $295.00 (2 Bids) Time Remaining: 1h 51m |
![]() 15 Ladder Tree Stand Fixed for Deer Hunting collecting Whitetail Antlers $64.00 Time Remaining: 9d 3h 29m Buy It Now for only: $64.00 |
![]() HUGE SUPER TALL NON TYP MULE DEER SKULL FROM ARIZONA STRIP ANTLERS ELK $99.99 Time Remaining: 4h 7m |
![]() Vintage Deer Antlers Mounted Leather and Wood Plaque Taxidermy Oddities Trophy $29.99 (1 Bid) Time Remaining: 1h 16m |
![]() Legendary Whitetails Lanyard Deergear whitetail deer hunting antler clothing $4.99 Time Remaining: 1d 15h 44m Buy It Now for only: $4.99 |
![]() 8 point whitetail antler deer mount $99.99 Time Remaining: 1h 7m |
![]() 10 REAL ELK ANTLER TIPSORNAMENTSJEWELERYDESIGNDECORCARVINGNATURAL $8.00 Time Remaining: 29d 23h 30m Buy It Now for only: $8.00 |
![]() Set of shed 5 point white tailed deer antlers $16.50 (3 Bids) Time Remaining: 2d 4m |
![]() Taxidermy Hunting Trophy Axis Buck Deer Antlers Skull and Horns $39.00 (1 Bid) Time Remaining: 34m |
![]() 3 REAL DEER CRAFT ANTLERSDECORBASKETSGOURDCRAFTLAMPSRUSTICNATURALREAL $24.99 Time Remaining: 29d 23h 15m Buy It Now for only: $24.99 |
![]() Lot of 20 Deer Antler Tines Crafts Jewelry 6 7 1 Pound 3 Oz $19.00 Time Remaining: 51m Buy It Now for only: $22.00 |
![]() 3 REAL DEER CRAFT ANTLERSDECORBASKETSGOURDCRAFTLAMPSRUSTICNATURALREAL $24.99 Time Remaining: 29d 23h 17m Buy It Now for only: $24.99 |
![]() Lot of 75 Deer Antler Tines Crafts Jewelry 2 4 1 Pound 15 Oz $23.00 Time Remaining: 57m Buy It Now for only: $28.00 |
![]() shed deer antlers whitetail $32.00 (7 Bids) Time Remaining: 2h 47m |
![]() Deer Craft Antler Tips 50 long $40.00 Time Remaining: 2d 21h 59m Buy It Now for only: $40.00 |
![]() WHITETAIL DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $51.00 (2 Bids) Time Remaining: 3d 57m |
![]() 4 ALL NATURAL ANTLER DOG CHEWSTREATSTOYNUTRITIONPETELKREALBONEDEERHORN $12.99 Time Remaining: 25d 19h 31m Buy It Now for only: $12.99 |
![]() BRUSH WOLF COYOTE TAXIDERMY TRAPS FUR COMPOUND BOW NATIVE AMERICAN ANTLERS CRAFT $164.49 (24 Bids) Time Remaining: 2d 1h 22m |
![]() Key Chain Hand Carved Deer Shed Antler Morel Mushroom Carving Taxidermy $10.50 (2 Bids) Time Remaining: 2h 25m |
![]() 10 REAL DEER ANTLERSDECORRUSTICBASKETSGOURDCRAFTANTLERHORNDESIGNART $32.99 Time Remaining: 29d 22h 52m Buy It Now for only: $32.99 |
![]() Montana Pronghorn Antelope Shoulder Mount Taxidermy Antlers Cabin $127.50 (5 Bids) Time Remaining: 3d 57m |
![]() Deer Craft Antler Tips 100 $50.00 Time Remaining: 1d 2h 41m Buy It Now for only: $50.00 |
![]() shed antlers whitetail deer $28.77 (5 Bids) Time Remaining: 3h 5m |
![]() Vintage JACKALOPE Genuine Rabbit Hear w Deer Antlers Taxidermy Western Decor EC $73.00 (25 Bids) Time Remaining: 2d 1h 14m |
![]() LARGE ELK BURR ANTLER BURRS ANTLERS CARVING $13.95 Time Remaining: 28d 20h 33m Buy It Now for only: $13.95 |
![]() NICE 10 POINT DEER ANTLER RACK TAXIDERMY SKULL MOUNT $13.50 (2 Bids) Time Remaining: 1d 20h 49m |
![]() 5X5 DEER RACKANTLERSWALL APPEALDESIGNDECORREALTAXIDERMYCABINHOME GIFT $55.00 Time Remaining: 29d 23h 5m Buy It Now for only: $55.00 |
![]() MINK TAXIDERMY TRAPPING FUR ARCHERY ANTLERS HUNTING TURKEY CALLS OTHER $20.50 (6 Bids) Time Remaining: 2d 1h 12m |
![]() ELK SHEDS ANTLERS HORNS BIG 6 POINT 2 RIGHTS OFF SAME BULL $152.50 (14 Bids) Time Remaining: 1d 23h 42m |
![]() 6 REAL ELK BURRS HOME DESIGN ANTLER DECOR BUCKLE ART RUSTIC NATURAL CARVING $12.00 Time Remaining: 29d 23h 21m Buy It Now for only: $12.00 |
![]() ELK SHEDS ANTLERS HORNS PERFECT 7 POINT $61.60 (10 Bids) Time Remaining: 1d 23h 52m |
![]() Dokkens Shed Antler Training Book Train Your Dog to Hunt For Shed Antlers $10.95 Time Remaining: 20d 3h 12m Buy It Now for only: $10.95 |
![]() 9 pt Whitetail antlers Unusual exceptional brow pts $145.00 Time Remaining: 2h 31m |
![]() Elk Burrs Rosette Craft Antler 32 large $26.00 (8 Bids) Time Remaining: 2d 17h 21m |
![]() ORIGINAL DEER ANTLERS MOUNTED FRAMED WITH A HAND MADE KNIFE $109.99 Time Remaining: 29d 13h 1m Buy It Now for only: $109.99 |
![]() 24 Whitetail Deer Shed Antlers Horns Crafts $31.00 (14 Bids) Time Remaining: 1d 1h 22m |
![]() 30 ANTLER PIECESBLANKSORNAMENTSJEWELERYDESIGNCARVINGPENPENSLATHECRAFT $19.99 Time Remaining: 15d 21h 41m Buy It Now for only: $19.99 |
![]() Elk Burrs Rosette Craft Antler 36 $20.50 (9 Bids) Time Remaining: 2d 17h 15m |
![]() Taxidermy FLYING squirrel neat deer antler fox cabin den funny farmer nuts cute $46.00 (21 Bids) Time Remaining: 1d 12h 8m |
![]() 4X4 DEER RACKANTLERSWALL APPEALDESIGNDECORREALTAXIDERMYCABINHOME GIFT $32.99 Time Remaining: 29d 22h 58m Buy It Now for only: $32.99 |
![]() 11 piece Deer Antler lot Great condition $22.50 (2 Bids) Time Remaining: 23h 57m |
![]() Legendary Whitetails Deer Camp Thermal Henley Deergear whitetails antler bucks $5.00 Time Remaining: 6d 15h 36m Buy It Now for only: $5.00 |
![]() Fallow Deer Antler Pair $35.00 Time Remaining: 12h 22m Buy It Now for only: $50.00 |
![]() WOW REAL WHITETAIL DEER and ELK ANTLER 3 TIER CHANDELIER $81.00 (5 Bids) Time Remaining: 1d 1h |
![]() Legendary Whitetails Chrome Decal Deergear Deer Antlers Trophy Buck Antler $4.99 Time Remaining: 12d 2h 15m Buy It Now for only: $4.99 |
![]() WHITETAIL DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $142.50 (2 Bids) Time Remaining: 4d 57m |
![]() Bone Collector Blaze Antlers Cap NEW HAT 100 974 $18.99 Time Remaining: 18d 17h 50m Buy It Now for only: $18.99 |
![]() 7 Whitetail Deer Antlers ALL DIFFERENT POINTS $25.00 (1 Bid) Time Remaining: 1h 22m |
![]() HUGE 214+ LONG BASE DOUBLE BEAM SET SHED WHITETAIL ANTLERS $282.00 (8 Bids) Time Remaining: 1d 23h 3m |
![]() JACKALOPE RABBIT Taxidermy Mount 6 point Antlers JackRabbit Bunny Hare d $128.98 Time Remaining: 28d 15m Buy It Now for only: $128.98 |
![]() NO RESERVE BIG 74+ HEAVY DENSE SHED WHITETAIL ANTLER $14.91 (2 Bids) Time Remaining: 1d 23h 42m |
![]() 5 ALL NATURAL ANTLER DOG CHEWSTREATSTOYNUTRITIONPETELKREALBONEDEERHORN $13.99 Time Remaining: 25d 19h 31m Buy It Now for only: $13.99 |
![]() ELK SHEDS ANTLERS HORNS BIG 6 X 6 SET NICE $186.50 (14 Bids) Time Remaining: 1d 23h 46m |
![]() OPOSSUM TRAPS HIDE TAXIDERMY PELT FUR LOG CABIN FISHING ANTLERS CAMO $0.99 (2 Bids) Time Remaining: 3d 1h 7m |
![]() Big 11pt Whitetail Deer Antlers Rack Horns 157 $165.00 Time Remaining: 6d 20h 41m Buy It Now for only: $165.00 |
![]() RED FOX TRAPS HIDE TAXIDERMY PELT FUR LOG CABIN MOUNTAINMAN MAN CAVE ANTLERS $57.00 (11 Bids) Time Remaining: 3d 1h 16m |
![]() 30 REAL ANTLER TIPSORNAMENTSDEERJEWELERYDESIGNDECORCARVINGNATURALELK $14.99 Time Remaining: 15d 21h 40m Buy It Now for only: $14.99 |
![]() FISHER TAXIDERMY TRAPPING FUR ANTLERS FISHING OTHER CAMO HUNTING ANTLERS $51.77 (4 Bids) Time Remaining: 3d 1h 17m |
![]() NO RESERVE KNARLY TEXTURED SET SHED WHITETAIL ANTLERS $21.61 (2 Bids) Time Remaining: 1d 22h 55m |
![]() Whitetail Deer Antlers Sheds Mount Iron Buck Mount $12.00 Time Remaining: 25d 17h 21m Buy It Now for only: $12.00 |
![]() NO RESERVE COOL KNARLY SPINY SET SHED WHITETAIL ANTLERS $21.61 (2 Bids) Time Remaining: 1d 23h 1m |
![]() DEER ANTLER KNIFE HANDLES $4.89 Time Remaining: 8d 19h 8m Buy It Now for only: $4.89 |
![]() NO RESERVE BIG 80+ SUPER CHARACTER SHED WHITETAIL ANTLER $11.61 (3 Bids) Time Remaining: 1d 23h 27m |
![]() NO RESERVE BIG 81+ THICK SHED WHITETAIL ANTLER $14.91 (2 Bids) Time Remaining: 1d 23h 33m |
![]() Walnut Creek Mount Deluxe Solid Oak Antler Mounting Display Kit $39.95 Time Remaining: 29d 12h 24m Buy It Now for only: $39.95 |
![]() pair Moose Antlers Antler Sheds Taxidermyfurbonesheds $1.00 (1 Bid) Time Remaining: 1d 21h 25m |
![]() Moose antlers wildlife horns shed taxidermy carving antler deer sheds set $210.00 Time Remaining: 26d 23h 50m Buy It Now for only: $210.00 |
![]() NO RESERVE BIG 86+ VERY TALL SHED WHITETAIL ANTLER $15.50 (7 Bids) Time Remaining: 1d 23h 30m |
![]() NO RESERVE BIG 85+ TALL SHED WHITETAIL ANTLER $11.61 (2 Bids) Time Remaining: 1d 23h 36m |
![]() EUROPEAN DEER PLAQUE SKULL MOUNT NO ANTLERS WALNUT OAK BARN CEDAR CHERRY $18.99 Time Remaining: 8d 13h 38m Buy It Now for only: $18.99 |
![]() NO RESERVE BIG 78+ GOOD LOOKER SHED WHITETAIL ANTLER $15.45 (2 Bids) Time Remaining: 1d 23h 39m |
![]() Realtree Outfitters Orange Embroidered Antler Logo AP Camo Visor RO241AP NEW $18.99 Time Remaining: 22d 16h 41m Buy It Now for only: $18.99 |
![]() Moose Antlers Antler Sheds Taxidermyfurbonesheds2 $5.75 (4 Bids) Time Remaining: 1d 21h 24m |
![]() Huge 4x4 Mule Deer Set + Eyeguards antlers western decor sheds taxidermy $74.99 (1 Bid) Time Remaining: 1d 16h 48m |
![]() Bone Collector Antler Dawn Black Mens Hunting T Shirt NEW Mike Waddell $19.99 Time Remaining: 14d 16h 19m Buy It Now for only: $19.99 |
![]() NO RESERVE FREAKY SET SHED WHITETAIL ANTLERS $21.61 (2 Bids) Time Remaining: 1d 22h 58m |
![]() The DogBone Shed Antler Retrieving Kit $26.99 Time Remaining: 8d 1h 57m Buy It Now for only: $26.99 |
![]() 4 NICE WHITE ELK SHEDS antlers horns deer craft cabin bow dog antler knife horn $33.00 (13 Bids) Time Remaining: 1d 1m |
![]() Moose Antlers Antler Sheds Taxidermyfurbonesheds3 $20.00 (27 Bids) Time Remaining: 1d 21h 25m |
![]() Shiras Set Moose Antlers Antler Sheds Taxidermyfurbonesheds $200.00 Time Remaining: 21d 19h 39m Buy It Now for only: $200.00 |
![]() BIG SETS Whitetail Deer Shed Antlers Horns Craft Arts Dog Chew Taxidermy Bone $26.55 (9 Bids) Time Remaining: 1d 22h 56m |
![]() Realtree Outfitters 3 D Antler Solid AP Camo Hat RO232AP $19.99 Time Remaining: 29d 16h 35m Buy It Now for only: $19.99 |
![]() Whitetail Deer Antlers Horns Rack decor $32.00 (3 Bids) Time Remaining: 11h 26m |
![]() 2 Big Thick Massive Fallow Deer Shed antlers antler Taxidermy Crafts Horns Horn $9.00 (1 Bid) Time Remaining: 2d 23h 37m |
![]() Small Hard to Find Texas Whitetail Deer Shed Antlers Antler Horn Horns Chews $36.00 Time Remaining: 29d 23h 21m Buy It Now for only: $36.00 |
![]() Deer Antler Morel Mushroom Carving Double Brow Tine $32.00 (7 Bids) Time Remaining: 23h 4m |
![]() Realtree AP Bone Collector Brotherhood Tshirt Deer Hunting NWT Skull Antlers XLG $14.99 Time Remaining: 7d 21h 45m Buy It Now for only: $14.99 |
![]() GORGEOUS HAND CARVEDMOREL MUSHROOMSDEER ELK ANTLER SHEDSHORNSCARVINGS 226 $30.00 (7 Bids) Time Remaining: 20h 38m |
![]() non tyipcal mule deer antlers $280.00 (1 Bid) Time Remaining: 10h 31m |
![]() Huge Whitetail Full Skull 233 inch Horn Antler Bone Taxidermy Real Booner $1,549.00 Time Remaining: 22d 15h 27m Buy It Now for only: $1,549.00 |
![]() MULE DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $49.00 Time Remaining: 5d 1h 39m |
Antlers Antler

TheThree Best Strategies For Utilizing Deer Antler Velvet
4 Ways You Can Really Benefit From Deer Antler Velvet
Deer Velvet is an amazing supplement on its own, and can offer the person using it a great deal of health benefits
Exercise: When I began my regimen of supplementation with deer antler velvet spray, I had fallen out of my workout routine for the first time in some odd years. This was bad for my overall fitness, but a great way to see if deer antler spray was all it was cracked up to be.
My first workout back had been a week prior to receiving my deer antler velvet spray, and the workout was pathetic, to say the least. The week of the deer antler spray, I got back to the gym, after an extremely hectic schedule, and went through the same routine, this time with much less strain and much more strength.
Chinups & pushups were a joke, and I could hardly get a sweat going with the stairmaster at a level that had previously worn me out after 15 short minutes.There was a much better pump in my muscles during the workout, which is another way of saying the blood in my circulatory system was traveling to my muscles and transporting much needed nutrients to them.
Rest: During that period where I found myself not working out on a regular basis, I noticed my body was enjoying the precious downtime that I hadn't alotted it in a while, and that directs us to that next component of the puzzle: rest.
Relaxing, getting to sleep, or recuperation of any form makes it possible for our body to mend whatever wear and tear may have been done through working out, or by way of daily life. An entire 7-8 hours of uninterrupted sleep, every single night, are recommended in order to really grant your body complete recovery.
The most crucial phases of sleep, and in particular in regards towards muscular growth & repair, will be while in stage 4 deep slumber.
All of our bodies begin to release human growth hormone during this phase.
Sleep along with the supplementation of deer velvet spray help make for considerably quicker muscle development coupled with recovery.
Your diet: Every proper fitness regimens or routines should include proper nutrition. Your body needs the right fuel to function and operate, and the level of fitness you can get to and the composition of your body is very much impacted by the kind of fuel you are feeding it. I will admit, I have personally noticed changes in my body composition as a result of just adding deer antler velvet spray into my daily routine, but I saw much more of an improvement when I cleaned up my eating habits.
This change in your eating doesn't have to be too drastic. You can start by reducing the amount of your meals daily to about three-quarters of what they normally are, or by increasing the frequency of your meals to about once every two hours. If you can fit in four or five small meals that are high in lean protein, low in fat, and moderate in carbohydrates, then you should notice a change right away.
|
Rest:
For the duration of that period in which I found myself not working out on consistantly, I realized my body was getting the precious relaxation which I had not permitted it for a long time, and that directs me to the next component of the puzzle: rest.
Resting, sleeping, or restoration of any form makes it possible for your body to repair what damage may have been done through physical activity, or throughout daily life. A good 7-8 hrs of sleep, every night, are recommended to successfully grant your body complete recuperation.
The most crucial levels of sleep, notably in regards to muscle growth & repair, will be in the course of stage 4 deep slumber.
All of our systems begin to produce growth hormone naturally at this phase.Rest} along with the supplementation of deer velvet spray produce considerably quicker muscle tissue development together with recovery.| With the IGF-1 encountered in deer antler spray, skeletal muscles are pushed to grow more quickly and deer velvet spray can aid an individual by helping their body release that growth hormone, even without the benefit of deep sleep, but that is not really ideal. A full night's sleep, in addition to deer velvet spray is a much better strategy than using the spray as an alternative to getting a healthy quantity of rest.}
Exercise:
When I began supplementing with deer velvet spray, also known as IGF-1, I had fallen out of my workout routine for the first time in some odd years. This was bad for my overall fitness.
This also gave me a chance to see if Deer Velvet was as effective as it had promised to be. This was going to be a real test of the legitimacy of the product. It was a much easier workout than I would have ever expected it to be.
Apart from the superficial components of physical exercise, working out strengthens the immune system and offers a much needed means, in our current world, to eliminate stress. Dopamine and seratonin are released through working out.
These two chemicals elevate mood and energy. They are responsible for what is known as "runner's high". Deer antler velvet spray is also believed to offer those same "side effects" and, despite the fact that it will accomplish that on its own without the exercise, the collaboration of utilizing deer velvet spray with physical exercise offers a lot more of the health and wellness benefits that can be received through deciding to do one or the other, versus both. A great approach of gaining the most out of deer antler spray and your workouts is to employ them in combination with one another.
Your diet: Every proper fitness regimens or routines should include proper nutrition. Your body needs the right fuel to function and operate, and the level of fitness you can get to and the composition of your body is very much impacted by the kind of fuel you are feeding it.
I will admit, I have personally noticed changes in my body composition as a result of just adding deer antler velvet spray into my daily routine, but I saw much more of an improvement when I cleaned up my eating habits.}
|
| }Finally, and most obvious of all of these tips, employ the deer velvet extract routinely!
I don't know just how many individuals I have discussed dietary supplements with that have complained concerning a product, but then I come to discover that they neglect to take it every now and then, or seldom take it at all!
Just like anything in life, you will need to be consistent
There you have a few ways to get the most out of your deer antler supplementation.You will want to eat well.
Make sure you get plenty of rest.Exercise and don't rely on the supplementation alone.And, lastly, be consistent in using the spray.You will see the benefits in no time.
About the Author
James McIntrye is a self-proclaimed health nut, on a quest to find out how he can best heal his body before it is ever hurting. Won't you join him?
What to use to give bleached deer antlers color?
I have a bunch of old bleached deer antlers and was wondering what I could use to give them a newer natural look. Like some kind of stain.
What colors of stain? Like a polyurethane? There are so many.
And for the leather stain, Are there lots of (browns) color choices?
Thanks everyone! I have gotten some great answers!
Colors of stain depends on the color you want the antlers to be.
ALWAYS start off with a light color. You can always go darker, you can NOT go lighter.
Wood stain would be your best bet- I prefer wood stain/s. There are TONS of colors from dark dark stains to stains that only seal the wood.
Also, don't use a polyurethane that has a high gloss- it's not natural looking. Go with a semi-gloss or no gloss.
Apply with a rag or part of an old (clean) sock. That will help for a better, more even coat on the antlers.
eBay antlerz antlers antler dog chew




































































































