Antlers Deer
![]() |
![]() MULE DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $351.00 (10 Bids) Time Remaining: 57m |
![]() RATTLE SNAKE POLYRESIN DECOR LIFE LIKE WHITETAIL DEER ANTLERS DEER SHEDS $30.00 Time Remaining: 7d 21h 38m Buy It Now for only: $30.00 |
![]() NO RESERVE HUGE 105 + CHARACTER SHED WHITETAIL ANTLER $71.00 (7 Bids) Time Remaining: 34m |
![]() 5X5 DEER RACKANTLERSWALL APPEALDESIGNDECORREALTAXIDERMYCABINHOME GIFT $55.00 Time Remaining: 29d 23h 4m Buy It Now for only: $55.00 |
![]() nice BIG 9 point from PA WHITETAILdeer antlers taxidermy shed rack buck horn $8.50 (5 Bids) Time Remaining: 49m |
![]() NO RESERVE HUGE 90 + SUPER LOOKER HEAVY MASS SHED WHITETAIL ANTLER $113.50 (7 Bids) Time Remaining: 36m |
![]() 4 ALL NATURAL ANTLER DOG CHEWSTREATSTOYNUTRITIONPETELKREALBONEDEERHORN $12.99 Time Remaining: 25d 19h 31m Buy It Now for only: $12.99 |
![]() 11 POINT WHITETAIL DEER MOUNT 135 taxidermy with replica antlers log homes $295.00 (2 Bids) Time Remaining: 1h 51m |
![]() DEER HORNS ANTLERS NO SKULL SKULLS COW BULL DL0007 $3.81 (4 Bids) Time Remaining: 57m |
![]() 20 ANTLER SLICESORNAMENTSJEWELERYDESIGNCARVINGDECORREALELKBUTTONSREAL $9.99 Time Remaining: 25d 19h 23m Buy It Now for only: $9.99 |
![]() 8 point whitetail antler deer mount $99.99 Time Remaining: 1h 6m |
![]() 3 REAL DEER CRAFT ANTLERSDECORBASKETSGOURDCRAFTLAMPSRUSTICNATURALREAL $24.99 Time Remaining: 29d 23h 15m Buy It Now for only: $24.99 |
![]() HUGE SUPER TALL NON TYP MULE DEER SKULL FROM ARIZONA STRIP ANTLERS ELK $99.99 Time Remaining: 4h 6m |
![]() Vintage Deer Antlers Mounted Leather and Wood Plaque Taxidermy Oddities Trophy $29.99 (1 Bid) Time Remaining: 1h 16m |
![]() 3 REAL DEER CRAFT ANTLERSDECORBASKETSGOURDCRAFTLAMPSRUSTICNATURALREAL $24.99 Time Remaining: 29d 23h 16m Buy It Now for only: $24.99 |
![]() WHITETAIL DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $51.00 (2 Bids) Time Remaining: 3d 56m |
![]() Taxidermy Hunting Trophy Axis Buck Deer Antlers Skull and Horns $39.00 (1 Bid) Time Remaining: 34m |
![]() 10 REAL DEER ANTLERSDECORRUSTICBASKETSGOURDCRAFTANTLERHORNDESIGNART $32.99 Time Remaining: 29d 22h 52m Buy It Now for only: $32.99 |
![]() shed deer antlers whitetail $32.00 (7 Bids) Time Remaining: 2h 47m |
![]() 10 REAL ELK ANTLER TIPSORNAMENTSJEWELERYDESIGNDECORCARVINGNATURAL $8.00 Time Remaining: 29d 23h 29m Buy It Now for only: $8.00 |
![]() Set of shed 5 point white tailed deer antlers $16.50 (3 Bids) Time Remaining: 2d 3m |
![]() Lot of 75 Deer Antler Tines Crafts Jewelry 2 4 1 Pound 15 Oz $23.00 Time Remaining: 57m Buy It Now for only: $28.00 |
![]() 30 ANTLER PIECESBLANKSORNAMENTSJEWELERYDESIGNCARVINGPENPENSLATHECRAFT $19.99 Time Remaining: 15d 21h 41m Buy It Now for only: $19.99 |
![]() shed antlers whitetail deer $42.57 (8 Bids) Time Remaining: 3h 5m |
![]() Lot of 20 Deer Antler Tines Crafts Jewelry 6 7 1 Pound 3 Oz $19.00 Time Remaining: 51m Buy It Now for only: $22.00 |
![]() 4X4 DEER RACKANTLERSWALL APPEALDESIGNDECORREALTAXIDERMYCABINHOME GIFT $32.99 Time Remaining: 29d 22h 58m Buy It Now for only: $32.99 |
![]() NICE 10 POINT DEER ANTLER RACK TAXIDERMY SKULL MOUNT $13.50 (2 Bids) Time Remaining: 1d 20h 48m |
![]() 24 Whitetail Deer Shed Antlers Horns Crafts $31.00 (14 Bids) Time Remaining: 1d 1h 22m |
![]() Deer Craft Antler Tips 100 $50.00 Time Remaining: 1d 2h 41m Buy It Now for only: $50.00 |
![]() Key Chain Hand Carved Deer Shed Antler Morel Mushroom Carving Taxidermy $10.50 (2 Bids) Time Remaining: 2h 25m |
![]() Deer Craft Antler Tips 50 long $40.00 Time Remaining: 2d 21h 59m Buy It Now for only: $40.00 |
![]() WHITETAIL DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $142.50 (2 Bids) Time Remaining: 4d 56m |
![]() BIG SETS Whitetail Deer Shed Antlers Horns Craft Arts Dog Chew Taxidermy Bone $26.55 (9 Bids) Time Remaining: 1d 22h 56m |
![]() ORIGINAL DEER ANTLERS MOUNTED FRAMED WITH A HAND MADE KNIFE $109.99 Time Remaining: 29d 13h Buy It Now for only: $109.99 |
![]() WOW REAL WHITETAIL DEER and ELK ANTLER 3 TIER CHANDELIER $81.00 (5 Bids) Time Remaining: 1d 59m |
![]() 2012 A+ Whitetail Deer Shed Antlers Craft Horns Arts Cabin Decor Taxidermy Dog $42.00 (10 Bids) Time Remaining: 22h 56m |
![]() 6 REAL ELK BURRS HOME DESIGN ANTLER DECOR BUCKLE ART RUSTIC NATURAL CARVING $12.00 Time Remaining: 29d 23h 21m Buy It Now for only: $12.00 |
![]() 2 Big Thick Massive Fallow Deer Shed antlers antler Taxidermy Crafts Horns Horn $9.00 (1 Bid) Time Remaining: 2d 23h 37m |
![]() Whitetail Deer Antlers Sheds Mount Iron Buck Mount $12.00 Time Remaining: 25d 17h 20m Buy It Now for only: $12.00 |
![]() Huge 15 pt Non Typ 182+ Whitetail Deer Antlers Rack Horns ShedsTaxidermy $150.00 (12 Bids) Time Remaining: 1d 19h 26m |
![]() Huge 4x4 Mule Deer Set + Eyeguards antlers western decor sheds taxidermy $74.99 (1 Bid) Time Remaining: 1d 16h 48m |
![]() NEW Deer Antler Horn Mounting Kit $13.99 Time Remaining: 11d 20h 7m Buy It Now for only: $13.99 |
![]() 11 piece Deer Antler lot Great condition $22.50 (2 Bids) Time Remaining: 23h 56m |
![]() Fallow Deer Antler Pair $35.00 Time Remaining: 12h 21m Buy It Now for only: $50.00 |
![]() EUROPEAN DEER PLAQUE SKULL MOUNT NO ANTLERS WALNUT OAK BARN CEDAR CHERRY $18.99 Time Remaining: 8d 13h 37m Buy It Now for only: $18.99 |
![]() Whitetail Deer Antlers Horns Rack decor $32.00 (3 Bids) Time Remaining: 11h 26m |
![]() 30 REAL ANTLER TIPSORNAMENTSDEERJEWELERYDESIGNDECORCARVINGNATURALELK $14.99 Time Remaining: 15d 21h 40m Buy It Now for only: $14.99 |
![]() 7 Axis Sides Deer Antlers Taxidermyshedsantlerfurbone $7.35 (4 Bids) Time Remaining: 1d 21h 34m |
![]() GORGEOUS HAND CARVEDMOREL MUSHROOMSDEER ELK ANTLER SHEDSHORNSCARVINGS 226 $30.00 (7 Bids) Time Remaining: 20h 37m |
![]() Big 11pt Whitetail Deer Antlers Rack Horns 157 $165.00 Time Remaining: 6d 20h 40m Buy It Now for only: $165.00 |
![]() MULE DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $49.00 Time Remaining: 5d 1h 39m |
![]() BIG LOT of Whitetail Deer Antlers Knife Makers Crafts Horns Arts Dog Chews $15.50 (5 Bids) Time Remaining: 1d 15h 10m |
![]() 5 ALL NATURAL ANTLER DOG CHEWSTREATSTOYNUTRITIONPETELKREALBONEDEERHORN $13.99 Time Remaining: 25d 19h 30m Buy It Now for only: $13.99 |
![]() 73 DROPBEAM Whitetail Deer Shed Antler Horns Rack Taxidermy Mount Collectable $49.99 (7 Bids) Time Remaining: 3d 23h 56m |
![]() 9 pt Whitetail antlers Unusual exceptional brow pts $145.00 Time Remaining: 2h 31m |
![]() LEADERS WHITETAIL DEER SHEDS ANTLERS ART BOW HUNTING MOTIVATIONAL ART MVP60 $9.95 Time Remaining: 5d 19h 35m Buy It Now for only: $9.95 |
![]() WHITETAIL Deer Mount 230+ Antlers Taxidermy Sheds $660.95 (19 Bids) Time Remaining: 3d 56m |
![]() ANTLER MOREL MUSHROOM SHED DEER ANTLER PRINT 11 X 14 PHOTOGRAPH NEW WHITETAIL $9.89 Time Remaining: 19d 17h 43m Buy It Now for only: $9.89 |
![]() HUGE DEER SKULL 12 POINT ANTLER EUROPEAN MOUNT HORNS TAXIDERMY HUNTING WILDLIFE $140.00 (1 Bid) Time Remaining: 1d 33m |
![]() NO RESERVE BIG 81+ THICK SHED WHITETAIL ANTLER $14.91 (2 Bids) Time Remaining: 1d 23h 33m |
![]() 10 LBS OF MULE DEER ANTLER DESIGN DECOR RUSTIC CABIN ANTLERS HORNS SHEDS HOME $59.99 Time Remaining: 25d 14h 16m Buy It Now for only: $59.99 |
![]() Deer Antler Morel Mushroom Carving Double Brow Tine $32.00 (7 Bids) Time Remaining: 23h 4m |
![]() NO RESERVE BIG 80+ SUPER CHARACTER SHED WHITETAIL ANTLER $11.61 (3 Bids) Time Remaining: 1d 23h 27m |
![]() Massive Whitetail Deer Buck head mount Minnesota antlers huge Gorgeous bar decor $999.00 Time Remaining: 2d 17h 20m Buy It Now for only: $999.00 |
![]() NO RESERVE BIG 86+ VERY TALL SHED WHITETAIL ANTLER $15.50 (7 Bids) Time Remaining: 1d 23h 29m |
![]() 14 REAL DEER SPIKE ANTLERSDECORRUSTICBASKETSGOURDCRAFTDESIGN $18.99 Time Remaining: 19d 2h 51m Buy It Now for only: $18.99 |
![]() NO RESERVE BIG 85+ TALL SHED WHITETAIL ANTLER $11.61 (2 Bids) Time Remaining: 1d 23h 35m |
![]() NO RESERVE BIG 78+ GOOD LOOKER SHED WHITETAIL ANTLER $15.45 (2 Bids) Time Remaining: 1d 23h 38m |
![]() Legendary Whitetails Outfitter Hoodie Deer gear hooded sweatshirt Antler White $29.99 Time Remaining: 18d 15h 11m Buy It Now for only: $29.99 |
![]() African Lion full mount taxidermy hunting antlers deer horns King of Jungle art $1,995.00 Time Remaining: 3d 16h 54m |
![]() Whitetail Deer 4x4 Antlers Taxidermy Vintage 8 point long brow tines old $20.50 (3 Bids) Time Remaining: 1d 17h 4m |
![]() UNFINISHED CHERRY EUROPEAN SKULL MOUNT DEER ANTLER PLAQUE $17.95 Time Remaining: 8d 10h Buy It Now for only: $17.95 |
![]() WHITETAIL DEER ANTLER CHANDELIER MADE FROM REAL ANTLERS $56.56 (2 Bids) Time Remaining: 6d 57m |
![]() Big 15pt Whitetail Deer Antlers Rack Sheds Horns 193 $495.00 Time Remaining: 5d 10h 58m Buy It Now for only: $495.00 |
![]() HUGE 214+ LONG BASE DOUBLE BEAM SET SHED WHITETAIL ANTLERS $282.00 (8 Bids) Time Remaining: 1d 23h 2m |
![]() 7 Point Whitetail full skull Euro Mount Taxidermy Log Cabin Decor Antlers Antler $31.00 (5 Bids) Time Remaining: 22h 17m |
![]() Deer Antler Chandelier $299.00 Time Remaining: 2d 20h 25m Buy It Now for only: $299.00 |
![]() Locked Antlers Whitetail Deer Antlers Skull Intact 1968 Vintage Barn Find $60.56 (4 Bids) Time Remaining: 1d 21h 52m |
![]() GORGEOUS HUGE DARK CHOCALATE WHITETAIL DEER ANTLERSDEER ELK HORNS SHEDS RACKS $51.00 (4 Bids) Time Remaining: 3d 23h 31m |
![]() Big 10pt Whitetail Deer Antlers Rack Horns 152 $175.00 Time Remaining: 8d 10h 57m Buy It Now for only: $175.00 |
![]() NO RESERVE KNARLY TEXTURED SET SHED WHITETAIL ANTLERS $21.61 (2 Bids) Time Remaining: 1d 22h 55m |
![]() NO RESERVE COOL KNARLY SPINY SET SHED WHITETAIL ANTLERS $21.61 (2 Bids) Time Remaining: 1d 23h 1m |
![]() 9 REAL DEER BURRS HOME DESIGN ANTLER DECOR KNOBS ART HARDWARE CABIN RUSTIC $9.99 Time Remaining: 2h 45m Buy It Now for only: $9.99 |
![]() Lot of 25 Deer Antler Tines Crafts Jewelry 5 7 1 Pound 5 oz $20.00 Time Remaining: 1h 57m Buy It Now for only: $23.00 |
![]() Small Hard to Find Texas Whitetail Deer Shed Antlers Antler Horn Horns Chews $36.00 Time Remaining: 29d 23h 21m Buy It Now for only: $36.00 |
![]() whitetail deer antlers sheds hunting archery horns $14.99 Time Remaining: 1d 16h 19m |
![]() 9 set Mule Deer Whitetail Sides Deer Antlers Taxidermyshedsantlerfurbone $32.00 (7 Bids) Time Remaining: 1d 21h 33m |
![]() Skull Mount BRACKET Antler Buck Panel Plaque Deer Iron $10.99 Time Remaining: 27d 23h 1m Buy It Now for only: $10.99 |
![]() Jackalope deer real horns antlers taxidermy animals mount western decor $59.00 Time Remaining: 1d 23h 43m Buy It Now for only: $69.00 |
![]() 8 Point Whitetail full skull Euro Mount Taxidermy Log Cabin Decor Antlers Antler $22.50 (4 Bids) Time Remaining: 22h 25m |
![]() DEER ANTLER CABINET PULLS FOR CUSTOM CABINETS LOGHOME KITCHEN REMODEL $8.00 Time Remaining: 22d 11h 30m Buy It Now for only: $8.00 |
![]() Whitetail Deer Antlers $13.50 (2 Bids) Time Remaining: 2d 2h 45m |
![]() European Skull Mount Bracket Antler Deer Hook Hanger $10.99 Time Remaining: 13h 16m Buy It Now for only: $10.99 |
![]() HUGE 74 4PT Whitetail Deer Shed Antlers Mount Horns Cabin Decor Taxidermy Mount $5.13 (3 Bids) Time Remaining: 5d 23h 57m |
![]() DEER ANTLER TIP PENDANT NECKLACE Jewelry with CHEVRON BEADS and Unique Beads $9.99 (1 Bid) Time Remaining: 3h 36m |
![]() NEW WHITETAIL DEER ANTLER CHANDELIER LIGHT 3 ANTLERS 3 LIGHTS12X20 MADE IN USA $159.95 Time Remaining: 16d 1h Buy It Now for only: $159.95 |
![]() XL 27 Neck Whitetail Deer Head Ready For Antlers Shoulder Mount Antler Shed 95 $239.00 Time Remaining: 19h 29m Buy It Now for only: $265.99 |
![]() NO RESERVE FREAKY SET SHED WHITETAIL ANTLERS $21.61 (2 Bids) Time Remaining: 1d 22h 58m |
![]() DROP TINES 185 DEER ANTLERS 12 point TAXIDERMY $110.00 Time Remaining: 28d 13h 5m Buy It Now for only: $110.00 |
![]() Set of shed 5 point white tailed deer antlers $15.50 (3 Bids) Time Remaining: 2d |
Antlers Deer

Deer in the Thickets
It is hard to believe that an animal as large as a big buck deer with the equivalent of a chair on its head could move about as easily as they do in a dense thicket. This is the choice place for them. One would think that they would choose easier walking paths, but they are seeking security and want to hang on to those trophy racks. At night they choose easier paths, and in fact they do most of their meandering at that time. But since you are a daytime hunter, the thickets are your best chance for a good deer. A stand near a thicket is a great bet for tempting a buck out into view by various means. A big buck can go through brambles like a rabbit. They have this uncanny ability to "get small" and sneak. There are rare recordings of antlered deer having been caught up in vines and dying as a result, but these are indeed uncommon. These situations probably occur when antlered bucks attempt to fight off predators in vine entanglements.
In the daytime, deer go where people are not expected to travel and where, if they decide to do so, their intrusion would be noticed.
Pressured deer go in search of such places. Big bucks head there as soon as they see early headlights on the roads and hear car doors slam. Any unusual activity sends smart deer hiding.
Deer in thickets stick tight in the relative safety of the underbrush. Scanning the edges just inside by careful glassing is a good bet. Rattling, or racking, or calling by various mouth calls are good methods to get them out to investigate. If you build a stand overlooking a thicket, don't give up looking for deer there. Deer bedded down stand up to stretch their legs just as we do. Keep looking for movement or some part of a deer. If you have chosen a likely thicket and have found good deer sign there, then you may catch them getting there when they seek it out. On a normal day most anywhere the time of day for such an encounter is generally around 9:00 A.M.
I have had the experience several times of getting within a yard or so distance from deer in thickets before they bolted. On each occasion I had not noticed the deer until the deer took off. Since it was always when I paused or switched directions that the deer arose so close to me, I am certain that I have passed by many deer which were laying low and expecting me to pass them by. Jump-hunting deer in thickets is a lot like hunting rabbits in the same habitat. One hunter can walk through a high field and not see a single rabbit. Another hunter can come through right after him and by zigzagging with frequent pauses cause the rabbits to panic and provide a shot. One time I had followed some fresh tracks to a thicket and while crawling on hands and knees noticed the legs and underside of a deer in the trail ahead. I slowly rose upright and shouldered my rifle to catch a look at the deer's head some twenty yards ahead when a humongous buck which was hidden in the honeysuckle thicket to my immediate left, bolted over the top of my head and scared the living daylights out of me. This big buck would have let me pass right by him had I not paused in that exact spot.
Good thickets are often found in "transition zones." Transition zones are the vegetation of mid size between, say, a field and a woods. Transition zones are located around the borders of clearings, fields, creeks, roads and other low-profile areas that are next to woodlands. These zones offer lots of branch-tip forage at forage height to the deer and also offer concealment. Since deer are considered "edge" animals such locations are natural choices for hunters to locate deer.
Abandoned cotton fields in the South which have fallowed into thickets are good deer locations.
Fallow fields, which have overgrown with staghorn sumac, make terrific choices for locating bedded bucks. The sumac offers high protein winter forage and deer antlers blend in perfectly with the branch structure.
For the stand hunter scoped rifles are useful for spotting animals in thickets and choosing shots which bypass obstructions. The stalker and still-hunter are better off using a brush gun.
One final note that Christmas tree plantations harbor deer herds.
About the Author
Albie Berk enjoys hunting and sharing what he has learned and any successful tips he can with others. He enjoys
South Carolina hunting
and usually stays at
Will whitetail buck deer grow antlers if they have been castrated?
I have two 2 1/2 year old bucks. Last season they were very agressive durnig the rut. (October-January)
I enjoy them mostly because of their antlers. In my home state law require that I keep captive deer until their death. But I am concerned about their agression. If some way they where to get out they could be very dangerous.
This is why I want to castrate them to take away the aggression. Will this affect the growing of antlers?
They are pets and are like big dogs most of the year. During and around the rut are the only time they are mean.
Note: I do not recomend raiseing wild deer.
The effect of castration on antler development varies, depending on the age class of the deer and the stage of antler growth when the castration occurs. If a young fawn is castrated within the first few months, that deer will not develop pedicles and therefore never develop antlers. Older fawns that have been castrated have been documented of growing a permanent, small, knob-like mass of velvet. If an adult buck is castrated during antler growth and in the velvet, the lack of testosterone allows the velvet antlers to continue growing, omitting the velvet shedding stage and total ossification of antler. These antlers may go on growing for a long period of time creating large cactus racks. These antlers will not shed in the spring.
A buck with fully-developed, hard antlers that is castrated will shed his antlers soon after the occurrence. With little or no testosterone, the buck takes part in the same shed antler cycle as an intact buck but in a quicker period of time. The low testosterone levels retard protein transfer and assists in erosion between the antler and pedicel. The castrated buck’s antlers will drop within a few weeks. The following year the buck may produce another set of antlers that will remain velvet-covered and permanent.
Deer with Antlers caught in Rope Swing




































































































